IER5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18457T
Artikelname: IER5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18457T
Hersteller Artikelnummer: CNA18457T
Alternativnummer: MBL-CNA18457T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human IER5 (NP_057629.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 34kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: APQPAEDEPPAPPAVCPRKRCAAGVGGGPAGCPAPGSTPLKKPRRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPE
Target-Kategorie: IER5
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200