AMBP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1846P
Artikelname: AMBP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1846P
Hersteller Artikelnummer: CNA1846P
Alternativnummer: MBL-CNA1846P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-202 of human AMBP (NP_001624.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 39kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPR
Target-Kategorie: AMBP
Application Verdünnung: WB: WB,1:500 - 1:1000