Topors Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18526T
Artikelname: Topors Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18526T
Hersteller Artikelnummer: CNA18526T
Alternativnummer: MBL-CNA18526T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of mouse Topors (NP_598858.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 117kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFTNPEVRRFRYRTTMTRERSASLYSPSST
Target-Kategorie: Topors
Application Verdünnung: WB: WB,1:500 - 1:2000