SLC26A9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18530T
Artikelname: SLC26A9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18530T
Hersteller Artikelnummer: CNA18530T
Alternativnummer: MBL-CNA18530T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-660 of human SLC26A9 (NP_443166.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 87kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENAPPTDPNNNQTPANGTSVSYITFSPDSSSPAQSEPPASAEAPGEPSDMLASVPPFV
Target-Kategorie: SLC26A9
Application Verdünnung: WB: WB,1:500 - 1:2000