TMEM18 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18541T
Artikelname: TMEM18 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18541T
Hersteller Artikelnummer: CNA18541T
Alternativnummer: MBL-CNA18541T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-100 of human TMEM18 (NP_690047.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LLTCLSSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAP
Target-Kategorie: TMEM18
Application Verdünnung: WB: WB,1:500 - 1:2000