DTX3L Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18551T
Artikelname: DTX3L Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18551T
Hersteller Artikelnummer: CNA18551T
Alternativnummer: MBL-CNA18551T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 601-740 of human DTX3L (NP_612144.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 84kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: TSYGIQKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQRTAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYGYPDPSYLKRVKEELKAKGIE
Target-Kategorie: DTX3L
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200