PPP2R1A/PPP2R2A/PPP2R1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18571T
Artikelname: PPP2R1A/PPP2R2A/PPP2R1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18571T
Hersteller Artikelnummer: CNA18571T
Alternativnummer: MBL-CNA18571T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human PPP2R1A/PPP2R2A/PPP2R1BPPP2R1A (NP_055040.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSA
Target-Kategorie: PPP2R1A/PPP2R2A/PPP2R1B
Application Verdünnung: WB: WB,1:500 - 1:2000