PPP2R2B/PPP2R2C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA18572T
Artikelname: PPP2R2B/PPP2R2C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA18572T
Hersteller Artikelnummer: CNA18572T
Alternativnummer: MBL-CNA18572T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 108-220 of human PPP2R2B/PPP2R2CPPP2R2B (NP_858060.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLR
Target-Kategorie: PPP2R2B/PPP2R2C
Application Verdünnung: WB: WB,1:500 - 1:2000