Glucosylceramidase beta (GBA) Rabbit mAb, Clone: [ARC0500], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19057S
Artikelname: Glucosylceramidase beta (GBA) Rabbit mAb, Clone: [ARC0500], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19057S
Hersteller Artikelnummer: CNA19057S
Alternativnummer: MBL-CNA19057S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 437-536 of human Glucosylceramidase beta (GBA) (P04062).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0500]
Molekulargewicht: 60kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: VDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ
Target-Kategorie: GBA1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200