GST3/GSTP1 Rabbit mAb, Clone: [ARC0439], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19061S
Artikelname: GST3/GSTP1 Rabbit mAb, Clone: [ARC0439], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19061S
Hersteller Artikelnummer: CNA19061S
Alternativnummer: MBL-CNA19061S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-201 of human GST3/GSTP1 (P09211).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0439]
Molekulargewicht: 23kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVN
Target-Kategorie: GSTP1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200