Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb, Clone: [ARC0370], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19069S
Artikelname: Integrin alpha 5 (ITGA5/CD49e) Rabbit mAb, Clone: [ARC0370], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19069S
Hersteller Artikelnummer: CNA19069S
Alternativnummer: MBL-CNA19069S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC, ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5 (ITGA5/CD49e) (P08648).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0370]
Molekulargewicht: 115kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Target-Kategorie: ITGA5
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000|FC,1:50 - 1:200