Integrin alpha V (ITGAV/CD51) Rabbit mAb, Clone: [ARC50621], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19071P
Artikelname: Integrin alpha V (ITGAV/CD51) Rabbit mAb, Clone: [ARC50621], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19071P
Hersteller Artikelnummer: CNA19071P
Alternativnummer: MBL-CNA19071P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V (ITGAV/CD51) (NP_002201.2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC50621]
Molekulargewicht: 116kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
Target-Kategorie: ITGAV
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|FC,1:50 - 1:200