IRS1 Rabbit mAb, Clone: [ARC0486], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA19074S
| Artikelname: |
IRS1 Rabbit mAb, Clone: [ARC0486], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA19074S |
| Hersteller Artikelnummer: |
CNA19074S |
| Alternativnummer: |
MBL-CNA19074S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human IRS1 (P35568). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0486] |
| Molekulargewicht: |
132kDa |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
SSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKRHSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ |
| Target-Kategorie: |
IRS1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
