Leptin Receptor Rabbit mAb, Clone: [ARC0454], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19076S
Artikelname: Leptin Receptor Rabbit mAb, Clone: [ARC0454], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19076S
Hersteller Artikelnummer: CNA19076S
Alternativnummer: MBL-CNA19076S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human Leptin Receptor (P48357).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0454]
Molekulargewicht: 132kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EEQGLINSSVTKCFSSKNSPLKDSFSNSSWEIEAQAFFILSDQHPNIISPHLTFSEGLDELLKLEGNFPEENNDKKSIYYLGVTSIKKRESGVLLTDKSRV
Target-Kategorie: LEPR
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200