[KO Validated] MyD88 Rabbit mAb, Clone: [ARC52507], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19082P
Artikelname: [KO Validated] MyD88 Rabbit mAb, Clone: [ARC52507], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19082P
Hersteller Artikelnummer: CNA19082P
Alternativnummer: MBL-CNA19082P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MyD88 (NP_002459.3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC52507]
Molekulargewicht: 15kDa/20kDa/28kDa/31kDa/33kDa/34kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: LAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL
Target-Kategorie: MYD88
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:500 - 1:1000