Notch1 Rabbit mAb, Clone: [ARC0285], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19090S
Artikelname: Notch1 Rabbit mAb, Clone: [ARC0285], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19090S
Hersteller Artikelnummer: CNA19090S
Alternativnummer: MBL-CNA19090S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human Notch1 (P46531).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0285]
Molekulargewicht: 273kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
Target-Kategorie: NOTCH1
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:50 - 1:200