ENO2 Rabbit mAb, Clone: [ARC52246], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19091P
Artikelname: ENO2 Rabbit mAb, Clone: [ARC52246], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19091P
Hersteller Artikelnummer: CNA19091P
Alternativnummer: MBL-CNA19091P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 47-100 of human ENO2 (NP_001966.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC52246]
Molekulargewicht: 47kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: LELRDGDKQRYLGKGVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANA
Target-Kategorie: ENO2
Application Verdünnung: WB: WB,1:2000 - 1:10000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200