Osteopontin Rabbit mAb, Clone: [ARC0471], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA19092S
| Artikelname: |
Osteopontin Rabbit mAb, Clone: [ARC0471], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA19092S |
| Hersteller Artikelnummer: |
CNA19092S |
| Alternativnummer: |
MBL-CNA19092S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Osteopontin (P10451). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0471] |
| Molekulargewicht: |
35kDa |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
GAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF |
| Target-Kategorie: |
SPP1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
