PAI-1/Serpin E1 Rabbit mAb, Clone: [ARC0473], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19096S
Artikelname: PAI-1/Serpin E1 Rabbit mAb, Clone: [ARC0473], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19096S
Hersteller Artikelnummer: CNA19096S
Alternativnummer: MBL-CNA19096S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PAI-1/Serpin E1 (P05121).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0473]
Molekulargewicht: 45kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFS
Target-Kategorie: SERPINE1
Application Verdünnung: WB: WB,1:500 - 1:2000