DJ-1/PARK7 Rabbit mAb, Clone: [ARC0354], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19097S
Artikelname: DJ-1/PARK7 Rabbit mAb, Clone: [ARC0354], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19097S
Hersteller Artikelnummer: CNA19097S
Alternativnummer: MBL-CNA19097S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DJ-1/PARK7 (Q99497).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0354]
Molekulargewicht: 20kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKG
Target-Kategorie: PARK7
Application Verdünnung: WB: WB,1:500 - 1:2000