S100/S100A1 Rabbit mAb, Clone: [ARC0404], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA19107S
| Artikelname: |
S100/S100A1 Rabbit mAb, Clone: [ARC0404], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA19107S |
| Hersteller Artikelnummer: |
CNA19107S |
| Alternativnummer: |
MBL-CNA19107S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 2-94 of human S100/S100A1 (P23297). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0404] |
| Molekulargewicht: |
11kDa |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS |
| Target-Kategorie: |
S100A1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:1000 |
