S100B Rabbit mAb, Clone: [ARC50351], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19108P
Artikelname: S100B Rabbit mAb, Clone: [ARC50351], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19108P
Hersteller Artikelnummer: CNA19108P
Alternativnummer: MBL-CNA19108P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-92 of human S100B (NP_006263.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC50351]
Molekulargewicht: 11kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Target-Kategorie: S100B
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200