Serotonin transporter Rabbit mAb, Clone: [ARC0441], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19110S
Artikelname: Serotonin transporter Rabbit mAb, Clone: [ARC0441], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19110S
Hersteller Artikelnummer: CNA19110S
Alternativnummer: MBL-CNA19110S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Serotonin transporter (NP_001036.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0441]
Molekulargewicht: 70kDa/75kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLG
Target-Kategorie: SLC6A4
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200