[KO Validated] Smad3 Rabbit mAb, Clone: [ARC53861], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19115P
Artikelname: [KO Validated] Smad3 Rabbit mAb, Clone: [ARC53861], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19115P
Hersteller Artikelnummer: CNA19115P
Alternativnummer: MBL-CNA19115P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Smad3 (NP_005893.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC53861]
Molekulargewicht: 48kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: HHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM
Target-Kategorie: SMAD3
Application Verdünnung: WB: WB,1:2000 - 1:20000|IHC-P,1:50 - 1:200|IP,1:100 - 1:500