[KO Validated] SUMO1 Rabbit mAb, Clone: [ARC0215], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19121S
Artikelname: [KO Validated] SUMO1 Rabbit mAb, Clone: [ARC0215], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19121S
Hersteller Artikelnummer: CNA19121S
Alternativnummer: MBL-CNA19121S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-101 of human Sumo 1 (P63165).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0215]
Molekulargewicht: 12kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Target-Kategorie: SUMO1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200