TLR7 Rabbit mAb, Clone: [ARC0401], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA19126S
| Artikelname: |
TLR7 Rabbit mAb, Clone: [ARC0401], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA19126S |
| Hersteller Artikelnummer: |
CNA19126S |
| Alternativnummer: |
MBL-CNA19126S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human TLR7 (Q9NYK1). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0401] |
| Molekulargewicht: |
121kDa |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
SKKTVFVMTDKYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQAHPYFWQCLKNALATDNHVAYSQVFKETV |
| Target-Kategorie: |
TLR7 |
| Application Verdünnung: |
WB: WB,1:100 - 1:500 |
