TNFR2/TNFRSF1B Rabbit mAb, Clone: [ARC0397], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19127S
Artikelname: TNFR2/TNFRSF1B Rabbit mAb, Clone: [ARC0397], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19127S
Hersteller Artikelnummer: CNA19127S
Alternativnummer: MBL-CNA19127S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 362-461 of human TNFR2/TNFRSF1B (P20333).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0397]
Molekulargewicht: 48kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQVPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
Target-Kategorie: TNFRSF1B
Application Verdünnung: WB: WB,1:500 - 1:2000