VCAM1 Rabbit mAb, Clone: [ARC0312], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19131S
Artikelname: VCAM1 Rabbit mAb, Clone: [ARC0312], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19131S
Hersteller Artikelnummer: CNA19131S
Alternativnummer: MBL-CNA19131S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 640-739 of human VCAM1 (P19320).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0312]
Molekulargewicht: 81kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: ETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFARKANMKGSYSLVEAQKSKV
Target-Kategorie: VCAM1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200