CXCL10/IP-10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA19138P
Artikelname: CXCL10/IP-10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA19138P
Hersteller Artikelnummer: CNA19138P
Alternativnummer: MBL-CNA19138P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-98 of human CXCL10/IP-10 (NP_001556.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 11kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Target-Kategorie: CXCL10
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200