CNTF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1915T
Artikelname: CNTF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1915T
Hersteller Artikelnummer: CNA1915T
Alternativnummer: MBL-CNA1915T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 24-74 of human CNTF (NP_000605.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 23kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQ
Target-Kategorie: CNTF
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200