[KO Validated] Peroxiredoxin 2 (PRDX2) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1919S
Artikelname: [KO Validated] Peroxiredoxin 2 (PRDX2) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1919S
Hersteller Artikelnummer: CNA1919S
Alternativnummer: MBL-CNA1919S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human Peroxiredoxin 2 (Peroxiredoxin 2 (PRDX2)) (NP_859428.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 22kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWYEQGPKREVAAKLTPSGPSSVASWPLLNLWNLRFPIVKIMETLPPKSLRMMTVISI
Target-Kategorie: PRDX2
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200