Eph receptor B3 (EPHB3) Rabbit mAb, Clone: [ARC2384], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19229S
Artikelname: Eph receptor B3 (EPHB3) Rabbit mAb, Clone: [ARC2384], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19229S
Hersteller Artikelnummer: CNA19229S
Alternativnummer: MBL-CNA19229S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Eph receptor B3 (EPHB3) (EPHB3) (P54753).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2384]
Molekulargewicht: 110kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SELAWTSHPESGWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSDVASASSPFWM
Target-Kategorie: EPHB3
Application Verdünnung: WB: WB,1:500 - 1:1000