TROY/TNFRSF19 Rabbit mAb, Clone: [ARC2393], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19235S
Artikelname: TROY/TNFRSF19 Rabbit mAb, Clone: [ARC2393], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19235S
Hersteller Artikelnummer: CNA19235S
Alternativnummer: MBL-CNA19235S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2393]
Molekulargewicht: 46kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: RFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK
Target-Kategorie: TNFRSF19
Application Verdünnung: WB: WB,1:500 - 1:1000