RPL7A Rabbit mAb, Clone: [ARC2407], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19247S
Artikelname: RPL7A Rabbit mAb, Clone: [ARC2407], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19247S
Hersteller Artikelnummer: CNA19247S
Alternativnummer: MBL-CNA19247S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human RPL7A (P62424).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2407]
Molekulargewicht: 30kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MPKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIE
Target-Kategorie: RPL7A
Application Verdünnung: WB: WB,1:500 - 1:1000