Kinesin light chain 1 (KLC1) Rabbit mAb, Clone: [ARC2409], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19249S
Artikelname: Kinesin light chain 1 (KLC1) Rabbit mAb, Clone: [ARC2409], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19249S
Hersteller Artikelnummer: CNA19249S
Alternativnummer: MBL-CNA19249S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human Kinesin light chain 1 (KLC1) (Q07866).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2409]
Molekulargewicht: 65kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNG
Target-Kategorie: KLC1
Application Verdünnung: WB: WB,1:500 - 1:1000