NLK Rabbit mAb, Clone: [ARC2441], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19270S
Artikelname: NLK Rabbit mAb, Clone: [ARC2441], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19270S
Hersteller Artikelnummer: CNA19270S
Alternativnummer: MBL-CNA19270S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human NLK (NP_057315.3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2441]
Molekulargewicht: 58kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: AVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINP
Target-Kategorie: NLK
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200