TNNC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1927S
Artikelname: TNNC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1927S
Hersteller Artikelnummer: CNA1927S
Alternativnummer: MBL-CNA1927S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TNNC1 (NP_003271.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 18kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGV
Target-Kategorie: TNNC1
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200