NAT10 Rabbit mAb, Clone: [ARC2468], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19286S
Artikelname: NAT10 Rabbit mAb, Clone: [ARC2468], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19286S
Hersteller Artikelnummer: CNA19286S
Alternativnummer: MBL-CNA19286S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 750-1025 of human NAT10 (Q9H0A0).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2468]
Molekulargewicht: 116kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPK
Target-Kategorie: NAT10
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200