RCHY1 Rabbit mAb, Clone: [ARC2469], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19287S
Artikelname: RCHY1 Rabbit mAb, Clone: [ARC2469], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19287S
Hersteller Artikelnummer: CNA19287S
Alternativnummer: MBL-CNA19287S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human RCHY1 (Q96PM5).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2469]
Molekulargewicht: 30kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: HVLPCGHLLHRTCYEEMLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLDQQ
Target-Kategorie: RCHY1
Application Verdünnung: WB: WB,1:500 - 1:1000