ICAM-1/CD54 Rabbit mAb, Clone: [ARC0261], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19300S
Artikelname: ICAM-1/CD54 Rabbit mAb, Clone: [ARC0261], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19300S
Hersteller Artikelnummer: CNA19300S
Alternativnummer: MBL-CNA19300S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ICAM-1/CD54 (P05362).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0261]
Molekulargewicht: 58kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQ
Target-Kategorie: ICAM1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|FC,1:50 - 1:200