Caspase-4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA19305S
Artikelname: Caspase-4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA19305S
Hersteller Artikelnummer: CNA19305S
Alternativnummer: MBL-CNA19305S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-4 (NP_001216.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 43kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
Target-Kategorie: CASP4
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200