GTF2F1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA19315T
Artikelname: GTF2F1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA19315T
Hersteller Artikelnummer: CNA19315T
Alternativnummer: MBL-CNA19315T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 390-517 of GTF2F1 (NP_002087.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 58kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PSAEGGSTSSTLRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
Target-Kategorie: GTF2F1
Application Verdünnung: WB: WB,1:500 - 1:2000