MAN2A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA19323T
Artikelname: MAN2A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA19323T
Hersteller Artikelnummer: CNA19323T
Alternativnummer: MBL-CNA19323T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MAN2A2 (NP_006113.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 131kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VPPEPRPSFFSISPQDCQFALGGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMV
Target-Kategorie: MAN2A2
Application Verdünnung: WB: WB,1:500 - 1:1000