GLO1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1932S
Artikelname: GLO1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1932S
Hersteller Artikelnummer: CNA1932S
Alternativnummer: MBL-CNA1932S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human GLO1 (NP_006699.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 21kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM
Target-Kategorie: GLO1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200