GRIK2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1939S
Artikelname: GRIK2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1939S
Hersteller Artikelnummer: CNA1939S
Alternativnummer: MBL-CNA1939S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-300 of human GRIK2 (NP_068775.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 103kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: QGTTHVLRFGGIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILN
Target-Kategorie: GRIK2
Application Verdünnung: WB: WB,1:500 - 1:2000