Glypican 3 (GPC3) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA1946P
Artikelname: |
Glypican 3 (GPC3) Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA1946P |
Hersteller Artikelnummer: |
CNA1946P |
Alternativnummer: |
MBL-CNA1946P |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
FC, WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 481-580 of human Glypican 3 (GPC3) (NP_004475.1). |
Konjugation: |
Unconjugated |
Klonalität: |
Polyclonal |
Molekulargewicht: |
66kDa |
Puffer: |
PBS with 0.05% proclin300,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
Sequenz: |
GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH |
Target-Kategorie: |
GPC3 |
Application Verdünnung: |
WB: WB,1:500 - 1:1000|FC,1:50 - 1:200 |