Glypican 3 (GPC3) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1946P
Artikelname: Glypican 3 (GPC3) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1946P
Hersteller Artikelnummer: CNA1946P
Alternativnummer: MBL-CNA1946P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 481-580 of human Glypican 3 (GPC3) (NP_004475.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 66kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH
Target-Kategorie: GPC3
Application Verdünnung: WB: WB,1:500 - 1:1000|FC,1:50 - 1:200