SHOX Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA19517P
Artikelname: SHOX Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA19517P
Hersteller Artikelnummer: CNA19517P
Alternativnummer: MBL-CNA19517P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human SHOX (NP_000442.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 32kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: NGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDED
Target-Kategorie: SHOX
Application Verdünnung: WB: WB,1:500 - 1:1000