Acetyl-Histone H4-K5 Rabbit mAb, Clone: [ARC0002], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19525S
Artikelname: Acetyl-Histone H4-K5 Rabbit mAb, Clone: [ARC0002], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19525S
Hersteller Artikelnummer: CNA19525S
Alternativnummer: MBL-CNA19525S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: DOT, ICC, IF, IHC-P, WB
Spezies Reaktivität: All, Human, Mouse, Rat
Immunogen: A synthetic acetylated peptide around K5 of human Histone H4 (P62805).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0002]
Molekulargewicht: 11kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Target-Kategorie: Histone H4
Application Verdünnung: WB: DB,1:500 - 1:1000|WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200