C/EBPB Rabbit mAb, Clone: [ARC0017], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19538S
Artikelname: C/EBPB Rabbit mAb, Clone: [ARC0017], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19538S
Hersteller Artikelnummer: CNA19538S
Alternativnummer: MBL-CNA19538S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 246-345 of human C/EBPB (P17676).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0017]
Molekulargewicht: 36kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: TACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
Target-Kategorie: CEBPB
Application Verdünnung: WB: WB,1:500 - 1:1000