Aurora B Rabbit mAb, Clone: [ARC50905], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA19539P
Artikelname: Aurora B Rabbit mAb, Clone: [ARC50905], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA19539P
Hersteller Artikelnummer: CNA19539P
Alternativnummer: MBL-CNA19539P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aurora B (NP_004208.2).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC50905]
Molekulargewicht: 39kDa
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH
Target-Kategorie: AURKB
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:100 - 1:1000